PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00098301001
Common NameGSBRNA2T00098301001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 321aa    MW: 36413.1 Da    PI: 8.2643
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00098301001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.51.1e-31186241156
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          k+r++W++eLH+rF++a+++LGGs++AtPk+i++lm+v+gLt+++vkSHLQkYRl+
  GSBRNA2T00098301001 186 KQRRCWSSELHRRFLHALQKLGGSHVATPKQIRDLMQVDGLTNDEVKSHLQKYRLH 241
                          79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.339183243IPR017930Myb domain
SuperFamilySSF466892.11E-17184244IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.2E-27184244IPR009057Homeodomain-like
TIGRFAMsTIGR015573.6E-27186241IPR006447Myb domain, plants
PfamPF002494.0E-7188239IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MAKKGDNMDY TLKKKRCEDY IEALVEEQQK IQVFKRDLPL CLSLVTQAIE SYRKELSEFS  60
RSEHIQPEGS ERTTSECEGR DGCIALCEEF VPIKSCERVK DDEAENNIDK KKSEWLQLWN  120
QSPDPQSIED QTTNCDAFQP FQKGKLAYSQ PLKAITPTPT ASSSTAETGG NKKEMEQQKQ  180
LQMHRKQRRC WSSELHRRFL HALQKLGGSH VATPKQIRDL MQVDGLTNDE VKSHLQKYRL  240
HTRRPATPTL TNGCENPQQQ QLIVVEGIWV PSKDAVNNRV YAPVAVQPPP RSSPSEPRSI  300
QRCKPPTASS STHPLHLPLS *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00160DAPTransfer from AT1G25550Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1894761e-138AC189476.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB080N15, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013707926.10.0PREDICTED: two-component response regulator-like APRR2 isoform X1
TrEMBLA0A078IP170.0A0A078IP17_BRANA; BnaA07g37120D protein
STRINGBra012471.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34912863
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.11e-115G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]